Placeholder image of a protein
Icon representing a puzzle

2048: Revisiting Puzzle 83: Cardiotoxin

Closed since over 4 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
September 23, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups


  1. Avatar for Beta Folders 100 pts. 10,428
  2. Avatar for Gargleblasters 2. Gargleblasters 76 pts. 10,376
  3. Avatar for Go Science 3. Go Science 56 pts. 10,336
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 10,316
  5. Avatar for Marvin's bunch 5. Marvin's bunch 29 pts. 10,218
  6. Avatar for Contenders 6. Contenders 20 pts. 10,140
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 10,105
  8. Avatar for Australia 8. Australia 9 pts. 9,260
  9. Avatar for BOINC@Poland 9. BOINC@Poland 6 pts. 9,069
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 4 pts. 8,932

  1. Avatar for NeLikomSheet 21. NeLikomSheet Lv 1 46 pts. 10,025
  2. Avatar for fiendish_ghoul 22. fiendish_ghoul Lv 1 44 pts. 10,016
  3. Avatar for jobo0502 23. jobo0502 Lv 1 42 pts. 10,000
  4. Avatar for guineapig 24. guineapig Lv 1 40 pts. 10,000
  5. Avatar for blazegeek 25. blazegeek Lv 1 39 pts. 9,971
  6. Avatar for Deleted player 26. Deleted player pts. 9,933
  7. Avatar for Vinara 27. Vinara Lv 1 35 pts. 9,931
  8. Avatar for NPrincipi 28. NPrincipi Lv 1 34 pts. 9,928
  9. Avatar for ucad 29. ucad Lv 1 32 pts. 9,924
  10. Avatar for WBarme1234 30. WBarme1234 Lv 1 31 pts. 9,919

Comments