Placeholder image of a protein
Icon representing a puzzle

2048: Revisiting Puzzle 83: Cardiotoxin

Closed since over 4 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
September 23, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups


  1. Avatar for Beta Folders 100 pts. 10,428
  2. Avatar for Gargleblasters 2. Gargleblasters 76 pts. 10,376
  3. Avatar for Go Science 3. Go Science 56 pts. 10,336
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 10,316
  5. Avatar for Marvin's bunch 5. Marvin's bunch 29 pts. 10,218
  6. Avatar for Contenders 6. Contenders 20 pts. 10,140
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 10,105
  8. Avatar for Australia 8. Australia 9 pts. 9,260
  9. Avatar for BOINC@Poland 9. BOINC@Poland 6 pts. 9,069
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 4 pts. 8,932

  1. Avatar for phi16 41. phi16 Lv 1 18 pts. 9,822
  2. Avatar for Vincera 42. Vincera Lv 1 17 pts. 9,792
  3. Avatar for alcor29 43. alcor29 Lv 1 17 pts. 9,725
  4. Avatar for kentish_alex 44. kentish_alex Lv 1 16 pts. 9,721
  5. Avatar for georg137 45. georg137 Lv 1 15 pts. 9,660
  6. Avatar for equilibria 46. equilibria Lv 1 14 pts. 9,654
  7. Avatar for infjamc 47. infjamc Lv 1 13 pts. 9,634
  8. Avatar for ProfVince 48. ProfVince Lv 1 13 pts. 9,602
  9. Avatar for BarrySampson 49. BarrySampson Lv 1 12 pts. 9,592
  10. Avatar for jawz101 50. jawz101 Lv 1 11 pts. 9,495

Comments