Placeholder image of a protein
Icon representing a puzzle

2048: Revisiting Puzzle 83: Cardiotoxin

Closed since over 4 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
September 23, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups


  1. Avatar for Beta Folders 100 pts. 10,428
  2. Avatar for Gargleblasters 2. Gargleblasters 76 pts. 10,376
  3. Avatar for Go Science 3. Go Science 56 pts. 10,336
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 10,316
  5. Avatar for Marvin's bunch 5. Marvin's bunch 29 pts. 10,218
  6. Avatar for Contenders 6. Contenders 20 pts. 10,140
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 10,105
  8. Avatar for Australia 8. Australia 9 pts. 9,260
  9. Avatar for BOINC@Poland 9. BOINC@Poland 6 pts. 9,069
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 4 pts. 8,932

  1. Avatar for Oransche 61. Oransche Lv 1 6 pts. 8,976
  2. Avatar for Jajaboman 62. Jajaboman Lv 1 6 pts. 8,932
  3. Avatar for Wiz kid 63. Wiz kid Lv 1 5 pts. 8,929
  4. Avatar for antibot215 64. antibot215 Lv 1 5 pts. 8,891
  5. Avatar for tracybutt 65. tracybutt Lv 1 5 pts. 8,874
  6. Avatar for a5hm0r 66. a5hm0r Lv 1 5 pts. 8,843
  7. Avatar for zackallen 67. zackallen Lv 1 4 pts. 8,792
  8. Avatar for Merf 68. Merf Lv 1 4 pts. 8,754
  9. Avatar for PeterDav 69. PeterDav Lv 1 4 pts. 8,751
  10. Avatar for toshiue 70. toshiue Lv 1 4 pts. 8,737

Comments