Placeholder image of a protein
Icon representing a puzzle

2048: Revisiting Puzzle 83: Cardiotoxin

Closed since over 4 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
September 23, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups


  1. Avatar for Beta Folders 100 pts. 10,428
  2. Avatar for Gargleblasters 2. Gargleblasters 76 pts. 10,376
  3. Avatar for Go Science 3. Go Science 56 pts. 10,336
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 10,316
  5. Avatar for Marvin's bunch 5. Marvin's bunch 29 pts. 10,218
  6. Avatar for Contenders 6. Contenders 20 pts. 10,140
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 10,105
  8. Avatar for Australia 8. Australia 9 pts. 9,260
  9. Avatar for BOINC@Poland 9. BOINC@Poland 6 pts. 9,069
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 4 pts. 8,932

  1. Avatar for Zosa 81. Zosa Lv 1 2 pts. 8,408
  2. Avatar for Borets 82. Borets Lv 1 2 pts. 8,320
  3. Avatar for carxo 83. carxo Lv 1 2 pts. 8,311
  4. Avatar for Louis_LIB 84. Louis_LIB Lv 1 1 pt. 8,299
  5. Avatar for rezaefar 85. rezaefar Lv 1 1 pt. 8,280
  6. Avatar for kyoota 86. kyoota Lv 1 1 pt. 8,263
  7. Avatar for yayaa 87. yayaa Lv 1 1 pt. 8,262
  8. Avatar for Deleted player 88. Deleted player 1 pt. 8,235
  9. Avatar for BassPlayer 89. BassPlayer Lv 1 1 pt. 8,228
  10. Avatar for Todd6485577 90. Todd6485577 Lv 1 1 pt. 8,159

Comments