Placeholder image of a protein
Icon representing a puzzle

2051: Revisiting Puzzle 84: Giant Anemone

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
September 30, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 5 pts. 8,634
  2. Avatar for Czech National Team 12. Czech National Team 4 pts. 8,618
  3. Avatar for SETI.Germany 13. SETI.Germany 2 pts. 8,463
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 2 pts. 8,281
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,180
  6. Avatar for Eastern Prehistoric Force 16. Eastern Prehistoric Force 1 pt. 7,591
  7. Avatar for CH362_ButlerUniversity 17. CH362_ButlerUniversity 1 pt. 7,390
  8. Avatar for BT21s 18. BT21s 1 pt. 7,304
  9. Avatar for Team China 19. Team China 1 pt. 6,737
  10. Avatar for Window Group 20. Window Group 1 pt. 6,147
  1. Avatar for kevin everington 91. kevin everington Lv 1 3 pts. 8,296
  2. Avatar for Satina 92. Satina Lv 1 2 pts. 8,281
  3. Avatar for poopsteve420 93. poopsteve420 Lv 1 2 pts. 8,232
  4. Avatar for Dr.Sillem 94. Dr.Sillem Lv 1 2 pts. 8,226
  5. Avatar for Pornthip 95. Pornthip Lv 1 2 pts. 8,185
  6. Avatar for Savas 96. Savas Lv 1 2 pts. 8,180
  7. Avatar for Larini 97. Larini Lv 1 2 pts. 8,151
  8. Avatar for Mohoernchen 98. Mohoernchen Lv 1 2 pts. 8,141
  9. Avatar for Hellcat6 99. Hellcat6 Lv 1 2 pts. 8,130
  10. Avatar for carxo 100. carxo Lv 1 2 pts. 8,101

Comments