Placeholder image of a protein
Icon representing a puzzle

2051: Revisiting Puzzle 84: Giant Anemone

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
September 30, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 5 pts. 8,634
  2. Avatar for Czech National Team 12. Czech National Team 4 pts. 8,618
  3. Avatar for SETI.Germany 13. SETI.Germany 2 pts. 8,463
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 2 pts. 8,281
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,180
  6. Avatar for Eastern Prehistoric Force 16. Eastern Prehistoric Force 1 pt. 7,591
  7. Avatar for CH362_ButlerUniversity 17. CH362_ButlerUniversity 1 pt. 7,390
  8. Avatar for BT21s 18. BT21s 1 pt. 7,304
  9. Avatar for Team China 19. Team China 1 pt. 6,737
  10. Avatar for Window Group 20. Window Group 1 pt. 6,147
  1. Avatar for mabeck2021 141. mabeck2021 Lv 1 1 pt. 7,204
  2. Avatar for prometein 142. prometein Lv 1 1 pt. 7,146
  3. Avatar for Sim Ji Eun 143. Sim Ji Eun Lv 1 1 pt. 7,027
  4. Avatar for BrandonP-S 144. BrandonP-S Lv 1 1 pt. 7,000
  5. Avatar for xuankecai 145. xuankecai Lv 1 1 pt. 6,964
  6. Avatar for mad789 146. mad789 Lv 1 1 pt. 6,896
  7. Avatar for siriwan suwanmacho 147. siriwan suwanmacho Lv 1 1 pt. 6,860
  8. Avatar for ionasii 148. ionasii Lv 1 1 pt. 6,859
  9. Avatar for argyrw 149. argyrw Lv 1 1 pt. 6,815
  10. Avatar for zo3xiaJonWeinberg 150. zo3xiaJonWeinberg Lv 1 1 pt. 6,737

Comments