Placeholder image of a protein
Icon representing a puzzle

2051: Revisiting Puzzle 84: Giant Anemone

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
September 30, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups


  1. Avatar for BMB 4210 F 2021 21. BMB 4210 F 2021 1 pt. 3,378
  2. Avatar for HMT heritage 22. HMT heritage 1 pt. 3,378
  3. Avatar for Deleted group 23. Deleted group pts. 3,378

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 9,890
  2. Avatar for Galaxie 2. Galaxie Lv 1 79 pts. 9,875
  3. Avatar for gmn 3. gmn Lv 1 61 pts. 9,867
  4. Avatar for robgee 4. robgee Lv 1 47 pts. 9,867
  5. Avatar for Deleted player 5. Deleted player 35 pts. 9,860
  6. Avatar for alcor29 6. alcor29 Lv 1 26 pts. 9,857
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 19 pts. 9,806
  8. Avatar for toshiue 8. toshiue Lv 1 14 pts. 9,798
  9. Avatar for NinjaGreg 9. NinjaGreg Lv 1 10 pts. 9,797
  10. Avatar for silent gene 10. silent gene Lv 1 7 pts. 9,795

Comments