Placeholder image of a protein
Icon representing a puzzle

2051: Revisiting Puzzle 84: Giant Anemone

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
September 30, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups


  1. Avatar for BMB 4210 F 2021 21. BMB 4210 F 2021 1 pt. 3,378
  2. Avatar for HMT heritage 22. HMT heritage 1 pt. 3,378
  3. Avatar for Deleted group 23. Deleted group pts. 3,378

  1. Avatar for JOE.CADILLAC555 111. JOE.CADILLAC555 Lv 1 1 pt. 7,809
  2. Avatar for Jelito2008 112. Jelito2008 Lv 1 1 pt. 7,786
  3. Avatar for rinze 113. rinze Lv 1 1 pt. 7,774
  4. Avatar for vinsi 114. vinsi Lv 1 1 pt. 7,708
  5. Avatar for yayaa 115. yayaa Lv 1 1 pt. 7,698
  6. Avatar for andresesuarezj 116. andresesuarezj Lv 1 1 pt. 7,642
  7. Avatar for kyoota 117. kyoota Lv 1 1 pt. 7,637
  8. Avatar for Chanita 118. Chanita Lv 1 1 pt. 7,633
  9. Avatar for lingdu 119. lingdu Lv 1 1 pt. 7,616
  10. Avatar for Policeman5452 120. Policeman5452 Lv 1 1 pt. 7,591

Comments