Placeholder image of a protein
Icon representing a puzzle

2051: Revisiting Puzzle 84: Giant Anemone

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
September 30, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for BMB 4210 F 2021 21. BMB 4210 F 2021 1 pt. 3,378
  2. Avatar for HMT heritage 22. HMT heritage 1 pt. 3,378
  3. Avatar for Deleted group 23. Deleted group pts. 3,378
  1. Avatar for Aranok 121. Aranok Lv 1 1 pt. 7,570
  2. Avatar for Ent47 122. Ent47 Lv 1 1 pt. 7,559
  3. Avatar for Saruta Saengphetr 123. Saruta Saengphetr Lv 1 1 pt. 7,525
  4. Avatar for Sureerat Kunkham 124. Sureerat Kunkham Lv 1 1 pt. 7,513
  5. Avatar for nrademaker 125. nrademaker Lv 1 1 pt. 7,496
  6. Avatar for Apisara 126. Apisara Lv 1 1 pt. 7,475
  7. Avatar for sabrina.koh 127. sabrina.koh Lv 1 1 pt. 7,444
  8. Avatar for Apisit aiemploy 128. Apisit aiemploy Lv 1 1 pt. 7,443
  9. Avatar for samparadee 129. samparadee Lv 1 1 pt. 7,441
  10. Avatar for Chanikarn.jir 130. Chanikarn.jir Lv 1 1 pt. 7,417

Comments