Placeholder image of a protein
Icon representing a puzzle

2051: Revisiting Puzzle 84: Giant Anemone

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
September 30, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for BMB 4210 F 2021 21. BMB 4210 F 2021 1 pt. 3,378
  2. Avatar for HMT heritage 22. HMT heritage 1 pt. 3,378
  3. Avatar for Deleted group 23. Deleted group pts. 3,378
  1. Avatar for cjddig 151. cjddig Lv 1 1 pt. 6,467
  2. Avatar for jflat06 152. jflat06 Lv 1 1 pt. 6,147
  3. Avatar for Kanyapat 153. Kanyapat Lv 1 1 pt. 5,417
  4. Avatar for Ayushree 154. Ayushree Lv 1 1 pt. 5,399
  5. Avatar for Raphaelberges 155. Raphaelberges Lv 1 1 pt. 5,350
  6. Avatar for cbwest 156. cbwest Lv 1 1 pt. 3,573
  7. Avatar for ploypailin sangthong 157. ploypailin sangthong Lv 1 1 pt. 3,378
  8. Avatar for auradee2021 158. auradee2021 Lv 1 1 pt. 3,378
  9. Avatar for emolsen2021 159. emolsen2021 Lv 1 1 pt. 3,378
  10. Avatar for JPol421021 160. JPol421021 Lv 1 1 pt. 3,378

Comments