Placeholder image of a protein
Icon representing a puzzle

2051: Revisiting Puzzle 84: Giant Anemone

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
September 30, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups


  1. Avatar for BMB 4210 F 2021 21. BMB 4210 F 2021 1 pt. 3,378
  2. Avatar for HMT heritage 22. HMT heritage 1 pt. 3,378
  3. Avatar for Deleted group 23. Deleted group pts. 3,378

  1. Avatar for Pikkachurin 71. Pikkachurin Lv 1 7 pts. 8,720
  2. Avatar for AlphaFold2 72. AlphaFold2 Lv 1 7 pts. 8,691
  3. Avatar for Wiz kid 73. Wiz kid Lv 1 6 pts. 8,688
  4. Avatar for ShadowTactics 74. ShadowTactics Lv 1 6 pts. 8,634
  5. Avatar for stomjoh 75. stomjoh Lv 1 6 pts. 8,630
  6. Avatar for vybi 76. vybi Lv 1 5 pts. 8,618
  7. Avatar for Flagg65a 77. Flagg65a Lv 1 5 pts. 8,587
  8. Avatar for Arne Heessels 78. Arne Heessels Lv 1 5 pts. 8,577
  9. Avatar for pascal ochem 79. pascal ochem Lv 1 5 pts. 8,573
  10. Avatar for BassPlayer 80. BassPlayer Lv 1 4 pts. 8,560

Comments