Placeholder image of a protein
Icon representing a puzzle

2051: Revisiting Puzzle 84: Giant Anemone

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
September 30, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for BMB 4210 F 2021 21. BMB 4210 F 2021 1 pt. 3,378
  2. Avatar for HMT heritage 22. HMT heritage 1 pt. 3,378
  3. Avatar for Deleted group 23. Deleted group pts. 3,378
  1. Avatar for equilibria 81. equilibria Lv 1 4 pts. 8,501
  2. Avatar for dahast.de 82. dahast.de Lv 1 4 pts. 8,463
  3. Avatar for Beany 83. Beany Lv 1 4 pts. 8,423
  4. Avatar for Evica 84. Evica Lv 1 4 pts. 8,370
  5. Avatar for CharaLilith 85. CharaLilith Lv 1 3 pts. 8,369
  6. Avatar for abiogenesis 86. abiogenesis Lv 1 3 pts. 8,353
  7. Avatar for quackquack 87. quackquack Lv 1 3 pts. 8,346
  8. Avatar for karmakazee 88. karmakazee Lv 1 3 pts. 8,331
  9. Avatar for PeterDav 89. PeterDav Lv 1 3 pts. 8,323
  10. Avatar for Trajan464 90. Trajan464 Lv 1 3 pts. 8,301

Comments