Placeholder image of a protein
Icon representing a puzzle

2051: Revisiting Puzzle 84: Giant Anemone

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
September 30, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups


  1. Avatar for Beta Folders 100 pts. 9,892
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 80 pts. 9,875
  3. Avatar for Contenders 3. Contenders 63 pts. 9,830
  4. Avatar for Go Science 4. Go Science 49 pts. 9,806
  5. Avatar for Gargleblasters 5. Gargleblasters 37 pts. 9,759
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 28 pts. 9,636
  7. Avatar for Marvin's bunch 7. Marvin's bunch 21 pts. 9,633
  8. Avatar for Australia 8. Australia 15 pts. 8,995
  9. Avatar for Ogre's lab 9. Ogre's lab 11 pts. 8,935
  10. Avatar for AlphaFold 10. AlphaFold 8 pts. 8,691

  1. Avatar for gdnskye 162. gdnskye Lv 1 1 pt. 3,378
  2. Avatar for O Seki To 163. O Seki To Lv 1 1 pt. 3,378
  3. Avatar for nivedha 164. nivedha Lv 1 1 pt. 3,378
  4. Avatar for diceyGod 165. diceyGod Lv 1 1 pt. 3,378
  5. Avatar for DGKvismitha 166. DGKvismitha Lv 1 1 pt. 3,378
  6. Avatar for Sciren 167. Sciren Lv 1 1 pt. 3,378

Comments