Placeholder image of a protein
Icon representing a puzzle

2051: Revisiting Puzzle 84: Giant Anemone

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
September 30, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,892
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 80 pts. 9,875
  3. Avatar for Contenders 3. Contenders 63 pts. 9,830
  4. Avatar for Go Science 4. Go Science 49 pts. 9,806
  5. Avatar for Gargleblasters 5. Gargleblasters 37 pts. 9,759
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 28 pts. 9,636
  7. Avatar for Marvin's bunch 7. Marvin's bunch 21 pts. 9,633
  8. Avatar for Australia 8. Australia 15 pts. 8,995
  9. Avatar for Ogre's lab 9. Ogre's lab 11 pts. 8,935
  10. Avatar for AlphaFold 10. AlphaFold 8 pts. 8,691
  1. Avatar for vrinda.gupta 131. vrinda.gupta Lv 1 1 pt. 7,417
  2. Avatar for jonvore 132. jonvore Lv 1 1 pt. 7,390
  3. Avatar for Watcharapon.pho 133. Watcharapon.pho Lv 1 1 pt. 7,379
  4. Avatar for furi0us 134. furi0us Lv 1 1 pt. 7,373
  5. Avatar for deathbat_87 135. deathbat_87 Lv 1 1 pt. 7,373
  6. Avatar for warumporn 136. warumporn Lv 1 1 pt. 7,373
  7. Avatar for sed4906 137. sed4906 Lv 1 1 pt. 7,359
  8. Avatar for Tonzi 138. Tonzi Lv 1 1 pt. 7,326
  9. Avatar for PhilipS 139. PhilipS Lv 1 1 pt. 7,304
  10. Avatar for Kingsleyh 140. Kingsleyh Lv 1 1 pt. 7,304

Comments