Placeholder image of a protein
Icon representing a puzzle

2054: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
October 07, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 8,907
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 8,825
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,588
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 6,969
  5. Avatar for Window Group 15. Window Group 1 pt. 6,616
  6. Avatar for BIOB101 - Discover Biology 16. BIOB101 - Discover Biology 1 pt. 4,300
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 9,910
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 97 pts. 9,848
  3. Avatar for akaaka 3. akaaka Lv 1 93 pts. 9,816
  4. Avatar for MicElephant 4. MicElephant Lv 1 90 pts. 9,808
  5. Avatar for grogar7 5. grogar7 Lv 1 87 pts. 9,801
  6. Avatar for Phyx 6. Phyx Lv 1 83 pts. 9,789
  7. Avatar for guineapig 7. guineapig Lv 1 80 pts. 9,773
  8. Avatar for NinjaGreg 8. NinjaGreg Lv 1 77 pts. 9,761
  9. Avatar for Galaxie 9. Galaxie Lv 1 74 pts. 9,752
  10. Avatar for Deleted player 10. Deleted player 72 pts. 9,745

Comments