Placeholder image of a protein
Icon representing a puzzle

2054: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
October 07, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 8,907
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 8,825
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,588
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 6,969
  5. Avatar for Window Group 15. Window Group 1 pt. 6,616
  6. Avatar for BIOB101 - Discover Biology 16. BIOB101 - Discover Biology 1 pt. 4,300
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 9,910
  2. Avatar for Deleted player 2. Deleted player 78 pts. 9,898
  3. Avatar for toshiue 3. toshiue Lv 1 60 pts. 9,847
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 45 pts. 9,838
  5. Avatar for kyoota 5. kyoota Lv 1 33 pts. 9,808
  6. Avatar for silent gene 6. silent gene Lv 1 24 pts. 9,805
  7. Avatar for Maerlyn138 7. Maerlyn138 Lv 1 17 pts. 9,795
  8. Avatar for puxatudo 8. puxatudo Lv 1 12 pts. 9,785
  9. Avatar for Galaxie 9. Galaxie Lv 1 8 pts. 9,781
  10. Avatar for robgee 10. robgee Lv 1 6 pts. 9,745

Comments