Placeholder image of a protein
Icon representing a puzzle

2054: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 4 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
October 07, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups


  1. Avatar for Beta Folders 100 pts. 9,910
  2. Avatar for Go Science 2. Go Science 71 pts. 9,848
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 49 pts. 9,801
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 9,708
  5. Avatar for Contenders 5. Contenders 22 pts. 9,683
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 9,671
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 9,664
  8. Avatar for Czech National Team 8. Czech National Team 5 pts. 9,314
  9. Avatar for Australia 9. Australia 3 pts. 9,310
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 9,260

  1. Avatar for fishercat 51. fishercat Lv 1 11 pts. 9,207
  2. Avatar for Arne Heessels 52. Arne Heessels Lv 1 10 pts. 9,206
  3. Avatar for Alistair69 53. Alistair69 Lv 1 9 pts. 9,205
  4. Avatar for PeterDav 54. PeterDav Lv 1 9 pts. 9,186
  5. Avatar for equilibria 55. equilibria Lv 1 8 pts. 9,185
  6. Avatar for Todd6485577 56. Todd6485577 Lv 1 8 pts. 9,169
  7. Avatar for Beany 57. Beany Lv 1 8 pts. 9,162
  8. Avatar for heather-1 58. heather-1 Lv 1 7 pts. 9,154
  9. Avatar for zippyc137 59. zippyc137 Lv 1 7 pts. 9,153
  10. Avatar for AlkiP0Ps 60. AlkiP0Ps Lv 1 6 pts. 9,132

Comments