Placeholder image of a protein
Icon representing a puzzle

2054: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 4 years ago

Novice Novice Novice Novice Overall Overall Overall Overall Prediction Prediction Prediction Prediction

Summary


Created
October 07, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups


  1. Avatar for Beta Folders 100 pts. 9,910
  2. Avatar for Go Science 2. Go Science 71 pts. 9,848
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 49 pts. 9,801
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 9,708
  5. Avatar for Contenders 5. Contenders 22 pts. 9,683
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 9,671
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 9,664
  8. Avatar for Czech National Team 8. Czech National Team 5 pts. 9,314
  9. Avatar for Australia 9. Australia 3 pts. 9,310
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 9,260

  1. Avatar for harvardman 121. harvardman Lv 1 1 pt. 6,715
  2. Avatar for jflat06 122. jflat06 Lv 1 1 pt. 6,616
  3. Avatar for aspid 123. aspid Lv 1 1 pt. 5,941
  4. Avatar for ManVsYard 124. ManVsYard Lv 1 1 pt. 4,858
  5. Avatar for jaylyahely 125. jaylyahely Lv 1 1 pt. 4,484
  6. Avatar for O.R 126. O.R Lv 1 1 pt. 4,331
  7. Avatar for Madison Des 127. Madison Des Lv 1 1 pt. 4,300
  8. Avatar for kanneganti 128. kanneganti Lv 1 1 pt. 4,300
  9. Avatar for joshmiller 129. joshmiller Lv 1 1 pt. 4,300
  10. Avatar for sullivjack03 130. sullivjack03 Lv 1 1 pt. 4,300

Comments