Placeholder image of a protein
Icon representing a puzzle

2057: Revisiting Puzzle 86: Nematode

Closed since over 4 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
October 14, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for Czech National Team 11. Czech National Team 1 pt. 8,783
  2. Avatar for :) 12. :) 1 pt. 8,394
  3. Avatar for Ogre's lab 13. Ogre's lab 1 pt. 8,007
  4. Avatar for Kotocycle 14. Kotocycle 1 pt. 7,778
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 6,313
  6. Avatar for UPJ Biochem 25 16. UPJ Biochem 25 1 pt. 4,094

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 11,251
  2. Avatar for Bletchley Park 2. Bletchley Park Lv 1 97 pts. 11,100
  3. Avatar for dcrwheeler 3. dcrwheeler Lv 1 93 pts. 11,083
  4. Avatar for Galaxie 4. Galaxie Lv 1 90 pts. 11,062
  5. Avatar for robgee 5. robgee Lv 1 87 pts. 11,049
  6. Avatar for frood66 6. frood66 Lv 1 84 pts. 11,017
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 80 pts. 10,979
  8. Avatar for christioanchauvin 8. christioanchauvin Lv 1 77 pts. 10,945
  9. Avatar for NinjaGreg 9. NinjaGreg Lv 1 75 pts. 10,883
  10. Avatar for Phyx 10. Phyx Lv 1 72 pts. 10,877

Comments