Placeholder image of a protein
Icon representing a puzzle

2057: Revisiting Puzzle 86: Nematode

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
October 14, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Czech National Team 11. Czech National Team 1 pt. 8,783
  2. Avatar for :) 12. :) 1 pt. 8,394
  3. Avatar for Ogre's lab 13. Ogre's lab 1 pt. 8,007
  4. Avatar for Kotocycle 14. Kotocycle 1 pt. 7,778
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 6,313
  6. Avatar for UPJ Biochem 25 16. UPJ Biochem 25 1 pt. 4,094
  1. Avatar for jausmh
    1. jausmh Lv 1
    100 pts. 11,259
  2. Avatar for fpc 2. fpc Lv 1 76 pts. 11,258
  3. Avatar for Lotus23 3. Lotus23 Lv 1 56 pts. 11,257
  4. Avatar for frood66 4. frood66 Lv 1 41 pts. 11,256
  5. Avatar for Deleted player 5. Deleted player 29 pts. 11,240
  6. Avatar for LociOiling 6. LociOiling Lv 1 20 pts. 11,227
  7. Avatar for Oransche 7. Oransche Lv 1 14 pts. 11,089
  8. Avatar for Galaxie 8. Galaxie Lv 1 9 pts. 11,062
  9. Avatar for gmn 9. gmn Lv 1 6 pts. 11,038
  10. Avatar for alcor29 10. alcor29 Lv 1 4 pts. 11,006

Comments