Placeholder image of a protein
Icon representing a puzzle

2060: Revisiting Puzzle 87: Zinc Binding Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
October 21, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups


  1. Avatar for Ogre's lab 11. Ogre's lab 1 pt. 8,657
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 8,587
  3. Avatar for :) 13. :) 1 pt. 8,243
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,238
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 7,263
  6. Avatar for Window Group 16. Window Group 1 pt. 6,852
  7. Avatar for UPJ Biochem 25 17. UPJ Biochem 25 1 pt. 3,852

  1. Avatar for Deleted player 100 pts. 9,119
  2. Avatar for LociOiling 2. LociOiling Lv 1 78 pts. 9,119
  3. Avatar for NinjaGreg 3. NinjaGreg Lv 1 60 pts. 9,095
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 45 pts. 9,092
  5. Avatar for toshiue 5. toshiue Lv 1 33 pts. 9,090
  6. Avatar for kyoota 6. kyoota Lv 1 24 pts. 9,087
  7. Avatar for Maerlyn138 7. Maerlyn138 Lv 1 17 pts. 9,086
  8. Avatar for silent gene 8. silent gene Lv 1 12 pts. 9,079
  9. Avatar for MicElephant 9. MicElephant Lv 1 8 pts. 9,041
  10. Avatar for Bletchley Park 10. Bletchley Park Lv 1 6 pts. 9,019

Comments