Placeholder image of a protein
Icon representing a puzzle

2060: Revisiting Puzzle 87: Zinc Binding Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
October 21, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups

  1. Avatar for Ogre's lab 11. Ogre's lab 1 pt. 8,657
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 8,587
  3. Avatar for :) 13. :) 1 pt. 8,243
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,238
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 7,263
  6. Avatar for Window Group 16. Window Group 1 pt. 6,852
  7. Avatar for UPJ Biochem 25 17. UPJ Biochem 25 1 pt. 3,852
  1. Avatar for christioanchauvin 11. christioanchauvin Lv 1 66 pts. 8,993
  2. Avatar for dcrwheeler 12. dcrwheeler Lv 1 63 pts. 8,981
  3. Avatar for LociOiling 13. LociOiling Lv 1 60 pts. 8,966
  4. Avatar for borattt 14. borattt Lv 1 57 pts. 8,952
  5. Avatar for g_b 15. g_b Lv 1 55 pts. 8,940
  6. Avatar for grogar7 16. grogar7 Lv 1 52 pts. 8,935
  7. Avatar for jobo0502 17. jobo0502 Lv 1 50 pts. 8,930
  8. Avatar for gmn 18. gmn Lv 1 48 pts. 8,928
  9. Avatar for akaaka 19. akaaka Lv 1 46 pts. 8,925
  10. Avatar for kentish_alex 20. kentish_alex Lv 1 43 pts. 8,913

Comments