Placeholder image of a protein
Icon representing a puzzle

2060: Revisiting Puzzle 87: Zinc Binding Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
October 21, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups

  1. Avatar for Ogre's lab 11. Ogre's lab 1 pt. 8,657
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 8,587
  3. Avatar for :) 13. :) 1 pt. 8,243
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,238
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 7,263
  6. Avatar for Window Group 16. Window Group 1 pt. 6,852
  7. Avatar for UPJ Biochem 25 17. UPJ Biochem 25 1 pt. 3,852
  1. Avatar for Todd6485577 21. Todd6485577 Lv 1 41 pts. 8,910
  2. Avatar for monteecristo 22. monteecristo Lv 1 39 pts. 8,891
  3. Avatar for Bletchley Park 23. Bletchley Park Lv 1 37 pts. 8,890
  4. Avatar for robgee 24. robgee Lv 1 36 pts. 8,880
  5. Avatar for georg137 25. georg137 Lv 1 34 pts. 8,880
  6. Avatar for Vinara 26. Vinara Lv 1 32 pts. 8,878
  7. Avatar for silent gene 27. silent gene Lv 1 31 pts. 8,871
  8. Avatar for frood66 28. frood66 Lv 1 29 pts. 8,860
  9. Avatar for BarrySampson 29. BarrySampson Lv 1 28 pts. 8,857
  10. Avatar for Phyx 30. Phyx Lv 1 26 pts. 8,844

Comments