Placeholder image of a protein
Icon representing a puzzle

2060: Revisiting Puzzle 87: Zinc Binding Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
October 21, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups

  1. Avatar for Ogre's lab 11. Ogre's lab 1 pt. 8,657
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 8,587
  3. Avatar for :) 13. :) 1 pt. 8,243
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,238
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 7,263
  6. Avatar for Window Group 16. Window Group 1 pt. 6,852
  7. Avatar for UPJ Biochem 25 17. UPJ Biochem 25 1 pt. 3,852
  1. Avatar for CharaLilith 31. CharaLilith Lv 1 25 pts. 8,837
  2. Avatar for AlphaFold2 32. AlphaFold2 Lv 1 24 pts. 8,822
  3. Avatar for fishercat 33. fishercat Lv 1 22 pts. 8,818
  4. Avatar for DylanAAAaaa111 34. DylanAAAaaa111 Lv 1 21 pts. 8,809
  5. Avatar for Maerlyn138 35. Maerlyn138 Lv 1 20 pts. 8,800
  6. Avatar for ShadowTactics 36. ShadowTactics Lv 1 19 pts. 8,777
  7. Avatar for rezaefar 37. rezaefar Lv 1 18 pts. 8,772
  8. Avatar for jausmh 38. jausmh Lv 1 17 pts. 8,761
  9. Avatar for fiendish_ghoul 39. fiendish_ghoul Lv 1 16 pts. 8,756
  10. Avatar for WBarme1234 40. WBarme1234 Lv 1 15 pts. 8,751

Comments