Placeholder image of a protein
Icon representing a puzzle

2060: Revisiting Puzzle 87: Zinc Binding Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
October 21, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups

  1. Avatar for Ogre's lab 11. Ogre's lab 1 pt. 8,657
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 8,587
  3. Avatar for :) 13. :) 1 pt. 8,243
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,238
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 7,263
  6. Avatar for Window Group 16. Window Group 1 pt. 6,852
  7. Avatar for UPJ Biochem 25 17. UPJ Biochem 25 1 pt. 3,852
  1. Avatar for Wiz kid 41. Wiz kid Lv 1 14 pts. 8,748
  2. Avatar for Lotus23 42. Lotus23 Lv 1 13 pts. 8,734
  3. Avatar for xythus 43. xythus Lv 1 13 pts. 8,709
  4. Avatar for eusair 44. eusair Lv 1 12 pts. 8,707
  5. Avatar for kyoota 45. kyoota Lv 1 11 pts. 8,684
  6. Avatar for NPrincipi 46. NPrincipi Lv 1 11 pts. 8,674
  7. Avatar for BassPlayer 47. BassPlayer Lv 1 10 pts. 8,668
  8. Avatar for alcor29 48. alcor29 Lv 1 9 pts. 8,658
  9. Avatar for Borets 49. Borets Lv 1 9 pts. 8,657
  10. Avatar for Dr.Sillem 50. Dr.Sillem Lv 1 8 pts. 8,650

Comments