Placeholder image of a protein
Icon representing a puzzle

2060: Revisiting Puzzle 87: Zinc Binding Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
October 21, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups

  1. Avatar for Ogre's lab 11. Ogre's lab 1 pt. 8,657
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 8,587
  3. Avatar for :) 13. :) 1 pt. 8,243
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,238
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 7,263
  6. Avatar for Window Group 16. Window Group 1 pt. 6,852
  7. Avatar for UPJ Biochem 25 17. UPJ Biochem 25 1 pt. 3,852
  1. Avatar for maithra 51. maithra Lv 1 8 pts. 8,645
  2. Avatar for ucad 52. ucad Lv 1 7 pts. 8,635
  3. Avatar for PeterDav 53. PeterDav Lv 1 7 pts. 8,632
  4. Avatar for tracybutt 54. tracybutt Lv 1 6 pts. 8,609
  5. Avatar for Deet 55. Deet Lv 1 6 pts. 8,607
  6. Avatar for equilibria 56. equilibria Lv 1 5 pts. 8,605
  7. Avatar for ManVsYard 57. ManVsYard Lv 1 5 pts. 8,603
  8. Avatar for jawz101 58. jawz101 Lv 1 5 pts. 8,590
  9. Avatar for vybi 59. vybi Lv 1 4 pts. 8,587
  10. Avatar for zippyc137 60. zippyc137 Lv 1 4 pts. 8,587

Comments