Placeholder image of a protein
Icon representing a puzzle

2060: Revisiting Puzzle 87: Zinc Binding Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
October 21, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups

  1. Avatar for Ogre's lab 11. Ogre's lab 1 pt. 8,657
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 8,587
  3. Avatar for :) 13. :) 1 pt. 8,243
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,238
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 7,263
  6. Avatar for Window Group 16. Window Group 1 pt. 6,852
  7. Avatar for UPJ Biochem 25 17. UPJ Biochem 25 1 pt. 3,852
  1. Avatar for antibot215 61. antibot215 Lv 1 4 pts. 8,584
  2. Avatar for Larini 62. Larini Lv 1 4 pts. 8,578
  3. Avatar for AlkiP0Ps 63. AlkiP0Ps Lv 1 3 pts. 8,575
  4. Avatar for bamh 64. bamh Lv 1 3 pts. 8,549
  5. Avatar for Flagg65a 65. Flagg65a Lv 1 3 pts. 8,516
  6. Avatar for puxatudo 66. puxatudo Lv 1 3 pts. 8,514
  7. Avatar for toshiue 67. toshiue Lv 1 3 pts. 8,512
  8. Avatar for drumpeter18yrs9yrs 68. drumpeter18yrs9yrs Lv 1 2 pts. 8,499
  9. Avatar for argyrw 69. argyrw Lv 1 2 pts. 8,481
  10. Avatar for Trajan464 70. Trajan464 Lv 1 2 pts. 8,471

Comments