2069: Revisiting Puzzle 89: Cow Eye
Closed since over 4 years ago
Novice Overall PredictionSummary
- Created
- November 11, 2021
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY