Placeholder image of a protein
Icon representing a puzzle

2072: Revisiting Puzzle 90: Heliomicin

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
November 18, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for Czech National Team 11. Czech National Team 1 pt. 8,748
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 8,686
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 8,605
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,401
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 8,223
  1. Avatar for guineapig
    1. guineapig Lv 1
    100 pts. 9,796
  2. Avatar for Bletchley Park 2. Bletchley Park Lv 1 97 pts. 9,789
  3. Avatar for NinjaGreg 3. NinjaGreg Lv 1 93 pts. 9,786
  4. Avatar for LociOiling 4. LociOiling Lv 1 89 pts. 9,748
  5. Avatar for jobo0502 5. jobo0502 Lv 1 85 pts. 9,720
  6. Avatar for Galaxie 6. Galaxie Lv 1 82 pts. 9,704
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 79 pts. 9,695
  8. Avatar for g_b 8. g_b Lv 1 75 pts. 9,695
  9. Avatar for BootsMcGraw 9. BootsMcGraw Lv 1 72 pts. 9,685
  10. Avatar for MicElephant 10. MicElephant Lv 1 69 pts. 9,684

Comments