Placeholder image of a protein
Icon representing a puzzle

2072: Revisiting Puzzle 90: Heliomicin

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
November 18, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups


  1. Avatar for Contenders 100 pts. 9,789
  2. Avatar for Go Science 2. Go Science 70 pts. 9,786
  3. Avatar for Beta Folders 3. Beta Folders 47 pts. 9,748
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 9,720
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 19 pts. 9,704
  6. Avatar for Marvin's bunch 6. Marvin's bunch 11 pts. 9,674
  7. Avatar for Gargleblasters 7. Gargleblasters 7 pts. 9,613
  8. Avatar for Void Crushers 8. Void Crushers 4 pts. 9,445
  9. Avatar for Australia 9. Australia 2 pts. 9,393
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 9,258

  1. Avatar for guineapig
    1. guineapig Lv 1
    100 pts. 9,804
  2. Avatar for MicElephant 2. MicElephant Lv 1 76 pts. 9,803
  3. Avatar for LociOiling 3. LociOiling Lv 1 56 pts. 9,748
  4. Avatar for Galaxie 4. Galaxie Lv 1 41 pts. 9,700
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 29 pts. 9,695
  6. Avatar for puxatudo 6. puxatudo Lv 1 20 pts. 9,693
  7. Avatar for maithra 7. maithra Lv 1 14 pts. 9,692
  8. Avatar for fpc 8. fpc Lv 1 9 pts. 9,657
  9. Avatar for silent gene 9. silent gene Lv 1 6 pts. 9,648
  10. Avatar for BootsMcGraw 10. BootsMcGraw Lv 1 4 pts. 9,641

Comments