Placeholder image of a protein
Icon representing a puzzle

2075: Revisiting Puzzle 91: Virus Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
November 25, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been, and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 3 pts. 9,014
  2. Avatar for Team China 12. Team China 2 pts. 8,938
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 8,844
  4. Avatar for Ogre's lab 14. Ogre's lab 1 pt. 8,626
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 8,184
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 8,159
  7. Avatar for Deleted group 18. Deleted group pts. 7,927
  8. Avatar for Foldit Staff 19. Foldit Staff 1 pt. 7,413
  9. Avatar for Biology 105 20. Biology 105 1 pt. 3,869

  1. Avatar for Simek 51. Simek Lv 1 11 pts. 9,394
  2. Avatar for AlkiP0Ps 52. AlkiP0Ps Lv 1 10 pts. 9,366
  3. Avatar for fishercat 53. fishercat Lv 1 9 pts. 9,341
  4. Avatar for zackallen 54. zackallen Lv 1 9 pts. 9,334
  5. Avatar for Alistair69 55. Alistair69 Lv 1 8 pts. 9,307
  6. Avatar for bamh 56. bamh Lv 1 8 pts. 9,293
  7. Avatar for PeterDav 57. PeterDav Lv 1 8 pts. 9,213
  8. Avatar for kyoota 58. kyoota Lv 1 7 pts. 9,109
  9. Avatar for Wiz kid 59. Wiz kid Lv 1 7 pts. 9,106
  10. Avatar for Arne Heessels 60. Arne Heessels Lv 1 6 pts. 9,090

Comments