Placeholder image of a protein
Icon representing a puzzle

2075: Revisiting Puzzle 91: Virus Protein

Closed since over 4 years ago

Novice Novice Novice Overall Overall Overall Prediction Prediction Prediction

Summary


Created
November 25, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been, and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,489
  2. Avatar for Gargleblasters 2. Gargleblasters 77 pts. 10,468
  3. Avatar for Beta Folders 3. Beta Folders 58 pts. 10,462
  4. Avatar for Go Science 4. Go Science 43 pts. 10,408
  5. Avatar for Marvin's bunch 5. Marvin's bunch 31 pts. 10,349
  6. Avatar for Contenders 6. Contenders 22 pts. 10,277
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 10,229
  8. Avatar for AlphaFold 8. AlphaFold 11 pts. 9,798
  9. Avatar for Void Crushers 9. Void Crushers 7 pts. 9,394
  10. Avatar for Australia 10. Australia 5 pts. 9,366

  1. Avatar for frostschutz 91. frostschutz Lv 1 1 pt. 8,512
  2. Avatar for Exonx 92. Exonx Lv 1 1 pt. 8,467
  3. Avatar for Jakki 94. Jakki Lv 1 1 pt. 8,429
  4. Avatar for carxo 95. carxo Lv 1 1 pt. 8,402
  5. Avatar for antibot215 96. antibot215 Lv 1 1 pt. 8,395
  6. Avatar for puxatudo 97. puxatudo Lv 1 1 pt. 8,293
  7. Avatar for Hellcat6 98. Hellcat6 Lv 1 1 pt. 8,285
  8. Avatar for north_zephyr 99. north_zephyr Lv 1 1 pt. 8,269
  9. Avatar for versat82 100. versat82 Lv 1 1 pt. 8,184

Comments