Placeholder image of a protein
Icon representing a puzzle

2075: Revisiting Puzzle 91: Virus Protein

Closed since over 4 years ago

Novice Novice Novice Overall Overall Overall Prediction Prediction Prediction

Summary


Created
November 25, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been, and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,489
  2. Avatar for Gargleblasters 2. Gargleblasters 77 pts. 10,468
  3. Avatar for Beta Folders 3. Beta Folders 58 pts. 10,462
  4. Avatar for Go Science 4. Go Science 43 pts. 10,408
  5. Avatar for Marvin's bunch 5. Marvin's bunch 31 pts. 10,349
  6. Avatar for Contenders 6. Contenders 22 pts. 10,277
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 10,229
  8. Avatar for AlphaFold 8. AlphaFold 11 pts. 9,798
  9. Avatar for Void Crushers 9. Void Crushers 7 pts. 9,394
  10. Avatar for Australia 10. Australia 5 pts. 9,366

  1. Avatar for Synarus 101. Synarus Lv 1 1 pt. 8,174
  2. Avatar for molleke 102. molleke Lv 1 1 pt. 8,159
  3. Avatar for soquasi 103. soquasi Lv 1 1 pt. 8,128
  4. Avatar for Andrew pro 104. Andrew pro Lv 1 1 pt. 8,112
  5. Avatar for Alex333 105. Alex333 Lv 1 1 pt. 8,106
  6. Avatar for Deet 106. Deet Lv 1 1 pt. 8,090
  7. Avatar for furi0us 107. furi0us Lv 1 1 pt. 8,086
  8. Avatar for CHT35 108. CHT35 Lv 1 1 pt. 8,082
  9. Avatar for carolaina 109. carolaina Lv 1 1 pt. 8,079
  10. Avatar for JustinRothganger 110. JustinRothganger Lv 1 1 pt. 8,051

Comments