Placeholder image of a protein
Icon representing a puzzle

2075: Revisiting Puzzle 91: Virus Protein

Closed since over 4 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
November 25, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been, and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,489
  2. Avatar for Gargleblasters 2. Gargleblasters 77 pts. 10,468
  3. Avatar for Beta Folders 3. Beta Folders 58 pts. 10,462
  4. Avatar for Go Science 4. Go Science 43 pts. 10,408
  5. Avatar for Marvin's bunch 5. Marvin's bunch 31 pts. 10,349
  6. Avatar for Contenders 6. Contenders 22 pts. 10,277
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 10,229
  8. Avatar for AlphaFold 8. AlphaFold 11 pts. 9,798
  9. Avatar for Void Crushers 9. Void Crushers 7 pts. 9,394
  10. Avatar for Australia 10. Australia 5 pts. 9,366

  1. Avatar for Phyx 11. Phyx Lv 1 69 pts. 10,288
  2. Avatar for guineapig 12. guineapig Lv 1 66 pts. 10,281
  3. Avatar for Bletchley Park 13. Bletchley Park Lv 1 64 pts. 10,277
  4. Avatar for xythus 14. xythus Lv 1 61 pts. 10,258
  5. Avatar for fiendish_ghoul 15. fiendish_ghoul Lv 1 59 pts. 10,236
  6. Avatar for christioanchauvin 16. christioanchauvin Lv 1 56 pts. 10,229
  7. Avatar for g_b 17. g_b Lv 1 54 pts. 10,207
  8. Avatar for silent gene 18. silent gene Lv 1 52 pts. 10,206
  9. Avatar for MicElephant 19. MicElephant Lv 1 50 pts. 10,197
  10. Avatar for robgee 20. robgee Lv 1 48 pts. 10,190

Comments