Placeholder image of a protein
Icon representing a puzzle

2075: Revisiting Puzzle 91: Virus Protein

Closed since over 4 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
November 25, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been, and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,489
  2. Avatar for Gargleblasters 2. Gargleblasters 77 pts. 10,468
  3. Avatar for Beta Folders 3. Beta Folders 58 pts. 10,462
  4. Avatar for Go Science 4. Go Science 43 pts. 10,408
  5. Avatar for Marvin's bunch 5. Marvin's bunch 31 pts. 10,349
  6. Avatar for Contenders 6. Contenders 22 pts. 10,277
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 10,229
  8. Avatar for AlphaFold 8. AlphaFold 11 pts. 9,798
  9. Avatar for Void Crushers 9. Void Crushers 7 pts. 9,394
  10. Avatar for Australia 10. Australia 5 pts. 9,366

  1. Avatar for akaaka 21. akaaka Lv 1 46 pts. 10,188
  2. Avatar for jobo0502 22. jobo0502 Lv 1 44 pts. 10,157
  3. Avatar for NeLikomSheet 23. NeLikomSheet Lv 1 42 pts. 10,149
  4. Avatar for Idiotboy 24. Idiotboy Lv 1 40 pts. 10,120
  5. Avatar for Deleted player 25. Deleted player pts. 10,115
  6. Avatar for manu8170 26. manu8170 Lv 1 37 pts. 10,105
  7. Avatar for BootsMcGraw 27. BootsMcGraw Lv 1 35 pts. 10,100
  8. Avatar for nicobul 28. nicobul Lv 1 34 pts. 10,085
  9. Avatar for ucad 29. ucad Lv 1 32 pts. 10,083
  10. Avatar for ProfVince 30. ProfVince Lv 1 31 pts. 10,067

Comments