Placeholder image of a protein
Icon representing a puzzle

2080: Revisiting Puzzle 93: Spider Toxin

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
December 09, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Russian team 11. Russian team 2 pts. 8,488
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 8,415
  3. Avatar for Czech National Team 13. Czech National Team 1 pt. 7,998
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 7,603
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 6,509
  6. Avatar for StueveBio 16. StueveBio 1 pt. 5,875
  7. Avatar for Window Group 17. Window Group 1 pt. 5,610
  8. Avatar for test_group1 18. test_group1 1 pt. 668
  9. Avatar for Deleted group 19. Deleted group pts. 668
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 9,963
  2. Avatar for frood66 2. frood66 Lv 1 98 pts. 9,930
  3. Avatar for dcrwheeler 3. dcrwheeler Lv 1 95 pts. 9,899
  4. Avatar for christioanchauvin 4. christioanchauvin Lv 1 93 pts. 9,878
  5. Avatar for jobo0502 5. jobo0502 Lv 1 90 pts. 9,870
  6. Avatar for MicElephant 6. MicElephant Lv 1 87 pts. 9,863
  7. Avatar for g_b 7. g_b Lv 1 85 pts. 9,831
  8. Avatar for NinjaGreg 8. NinjaGreg Lv 1 83 pts. 9,807
  9. Avatar for Bruno Kestemont 9. Bruno Kestemont Lv 1 80 pts. 9,792
  10. Avatar for gmn 10. gmn Lv 1 78 pts. 9,782

Comments