Placeholder image of a protein
Icon representing a puzzle

2080: Revisiting Puzzle 93: Spider Toxin

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
December 09, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Russian team 11. Russian team 2 pts. 8,488
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 8,415
  3. Avatar for Czech National Team 13. Czech National Team 1 pt. 7,998
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 7,603
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 6,509
  6. Avatar for StueveBio 16. StueveBio 1 pt. 5,875
  7. Avatar for Window Group 17. Window Group 1 pt. 5,610
  8. Avatar for test_group1 18. test_group1 1 pt. 668
  9. Avatar for Deleted group 19. Deleted group pts. 668
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 9,962
  2. Avatar for jausmh 2. jausmh Lv 1 71 pts. 9,934
  3. Avatar for fpc 3. fpc Lv 1 49 pts. 9,914
  4. Avatar for MicElephant 4. MicElephant Lv 1 33 pts. 9,860
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 22 pts. 9,818
  6. Avatar for Galaxie 6. Galaxie Lv 1 14 pts. 9,786
  7. Avatar for gmn 7. gmn Lv 1 8 pts. 9,777
  8. Avatar for alcor29 8. alcor29 Lv 1 5 pts. 9,775
  9. Avatar for silent gene 9. silent gene Lv 1 3 pts. 9,774
  10. Avatar for Bletchley Park 10. Bletchley Park Lv 1 2 pts. 9,759

Comments