Placeholder image of a protein
Icon representing a puzzle

2080: Revisiting Puzzle 93: Spider Toxin

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
December 09, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,963
  2. Avatar for Marvin's bunch 2. Marvin's bunch 76 pts. 9,934
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 56 pts. 9,878
  4. Avatar for Go Science 4. Go Science 41 pts. 9,818
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 29 pts. 9,786
  6. Avatar for Contenders 6. Contenders 20 pts. 9,759
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 9,718
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 9,186
  9. Avatar for AlphaFold 9. AlphaFold 6 pts. 8,865
  10. Avatar for Australia 10. Australia 4 pts. 8,851
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 9,962
  2. Avatar for jausmh 2. jausmh Lv 1 71 pts. 9,934
  3. Avatar for fpc 3. fpc Lv 1 49 pts. 9,914
  4. Avatar for MicElephant 4. MicElephant Lv 1 33 pts. 9,860
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 22 pts. 9,818
  6. Avatar for Galaxie 6. Galaxie Lv 1 14 pts. 9,786
  7. Avatar for gmn 7. gmn Lv 1 8 pts. 9,777
  8. Avatar for alcor29 8. alcor29 Lv 1 5 pts. 9,775
  9. Avatar for silent gene 9. silent gene Lv 1 3 pts. 9,774
  10. Avatar for Bletchley Park 10. Bletchley Park Lv 1 2 pts. 9,759

Comments