Placeholder image of a protein
Icon representing a puzzle

2080: Revisiting Puzzle 93: Spider Toxin

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
December 09, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups


  1. Avatar for Beta Folders 100 pts. 9,963
  2. Avatar for Marvin's bunch 2. Marvin's bunch 76 pts. 9,934
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 56 pts. 9,878
  4. Avatar for Go Science 4. Go Science 41 pts. 9,818
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 29 pts. 9,786
  6. Avatar for Contenders 6. Contenders 20 pts. 9,759
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 9,718
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 9,186
  9. Avatar for AlphaFold 9. AlphaFold 6 pts. 8,865
  10. Avatar for Australia 10. Australia 4 pts. 8,851

  1. Avatar for Amandarodette 131. Amandarodette Lv 1 1 pt. 6,683
  2. Avatar for ksy12 132. ksy12 Lv 1 1 pt. 6,677
  3. Avatar for Ivanchek 133. Ivanchek Lv 1 1 pt. 6,658
  4. Avatar for Salon 134. Salon Lv 1 1 pt. 6,655
  5. Avatar for heyubob 135. heyubob Lv 1 1 pt. 6,629
  6. Avatar for germarc 136. germarc Lv 1 1 pt. 6,611
  7. Avatar for DomenicaSabatini 137. DomenicaSabatini Lv 1 1 pt. 6,532
  8. Avatar for s1920597 138. s1920597 Lv 1 1 pt. 6,516
  9. Avatar for Sciren 139. Sciren Lv 1 1 pt. 6,509
  10. Avatar for giribio 140. giribio Lv 1 1 pt. 6,440

Comments