Placeholder image of a protein
Icon representing a puzzle

2080: Revisiting Puzzle 93: Spider Toxin

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
December 09, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups


  1. Avatar for Beta Folders 100 pts. 9,963
  2. Avatar for Marvin's bunch 2. Marvin's bunch 76 pts. 9,934
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 56 pts. 9,878
  4. Avatar for Go Science 4. Go Science 41 pts. 9,818
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 29 pts. 9,786
  6. Avatar for Contenders 6. Contenders 20 pts. 9,759
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 9,718
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 9,186
  9. Avatar for AlphaFold 9. AlphaFold 6 pts. 8,865
  10. Avatar for Australia 10. Australia 4 pts. 8,851

  1. Avatar for burakkuzu 171. burakkuzu Lv 1 1 pt. 973
  2. Avatar for pemjaider 172. pemjaider Lv 1 1 pt. 788
  3. Avatar for mxn azazel 173. mxn azazel Lv 1 1 pt. 669
  4. Avatar for maximo silva 174. maximo silva Lv 1 1 pt. 669
  5. Avatar for FIMOSISFRITA 175. FIMOSISFRITA Lv 1 1 pt. 668
  6. Avatar for Vane2000 176. Vane2000 Lv 1 1 pt. 668
  7. Avatar for JoseOlivas 177. JoseOlivas Lv 1 1 pt. 668
  8. Avatar for Edward Alexis 178. Edward Alexis Lv 1 1 pt. 668
  9. Avatar for test_account1 179. test_account1 Lv 1 1 pt. 668
  10. Avatar for bkoep 180. bkoep Lv 1 1 pt. 668

Comments