Placeholder image of a protein
Icon representing a puzzle

2080: Revisiting Puzzle 93: Spider Toxin

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
December 09, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups


  1. Avatar for Beta Folders 100 pts. 9,963
  2. Avatar for Marvin's bunch 2. Marvin's bunch 76 pts. 9,934
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 56 pts. 9,878
  4. Avatar for Go Science 4. Go Science 41 pts. 9,818
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 29 pts. 9,786
  6. Avatar for Contenders 6. Contenders 20 pts. 9,759
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 9,718
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 9,186
  9. Avatar for AlphaFold 9. AlphaFold 6 pts. 8,865
  10. Avatar for Australia 10. Australia 4 pts. 8,851

  1. Avatar for phi16 61. phi16 Lv 1 14 pts. 8,837
  2. Avatar for drjr 62. drjr Lv 1 13 pts. 8,833
  3. Avatar for Arthuriel 63. Arthuriel Lv 1 13 pts. 8,825
  4. Avatar for Alistair69 64. Alistair69 Lv 1 12 pts. 8,777
  5. Avatar for Larini 65. Larini Lv 1 12 pts. 8,668
  6. Avatar for pinestone 66. pinestone Lv 1 11 pts. 8,630
  7. Avatar for DScott 67. DScott Lv 1 11 pts. 8,579
  8. Avatar for bamh 68. bamh Lv 1 11 pts. 8,576
  9. Avatar for Todd6485577 69. Todd6485577 Lv 1 10 pts. 8,514
  10. Avatar for kyoota 70. kyoota Lv 1 10 pts. 8,488

Comments