Placeholder image of a protein
Icon representing a puzzle

2080: Revisiting Puzzle 93: Spider Toxin

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
December 09, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,963
  2. Avatar for Marvin's bunch 2. Marvin's bunch 76 pts. 9,934
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 56 pts. 9,878
  4. Avatar for Go Science 4. Go Science 41 pts. 9,818
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 29 pts. 9,786
  6. Avatar for Contenders 6. Contenders 20 pts. 9,759
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 9,718
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 9,186
  9. Avatar for AlphaFold 9. AlphaFold 6 pts. 8,865
  10. Avatar for Australia 10. Australia 4 pts. 8,851
  1. Avatar for Punzi Baker 2 11. Punzi Baker 2 Lv 1 76 pts. 9,777
  2. Avatar for akaaka 12. akaaka Lv 1 74 pts. 9,758
  3. Avatar for Galaxie 13. Galaxie Lv 1 72 pts. 9,753
  4. Avatar for robgee 14. robgee Lv 1 70 pts. 9,745
  5. Avatar for BootsMcGraw 15. BootsMcGraw Lv 1 68 pts. 9,735
  6. Avatar for ZeroLeak7 16. ZeroLeak7 Lv 1 66 pts. 9,722
  7. Avatar for Phyx 17. Phyx Lv 1 64 pts. 9,663
  8. Avatar for guineapig 18. guineapig Lv 1 62 pts. 9,646
  9. Avatar for szinr 19. szinr Lv 1 60 pts. 9,643
  10. Avatar for silent gene 20. silent gene Lv 1 58 pts. 9,618

Comments