Foldit

2083: Revisiting Puzzle 94: Mouse

Closed since over 4 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created: December 16, 2021
Expires: December 23, 2021 at 18:00 UTC
Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence:

ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM