Placeholder image of a protein
Icon representing a puzzle

2083: Revisiting Puzzle 94: Mouse

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
December 16, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups


  1. Avatar for foldeRNA 11. foldeRNA 2 pts. 9,480
  2. Avatar for Russian team 12. Russian team 1 pt. 9,327
  3. Avatar for Void Crushers 13. Void Crushers 1 pt. 9,287
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 9,116
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,475
  6. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 7,426
  7. Avatar for Window Group 18. Window Group 1 pt. 6,794

  1. Avatar for HBK201 111. HBK201 Lv 1 2 pts. 8,147
  2. Avatar for i.lotsaris 112. i.lotsaris Lv 1 2 pts. 8,142
  3. Avatar for Cass_the_raptor 113. Cass_the_raptor Lv 1 2 pts. 8,117
  4. Avatar for cabralimon 114. cabralimon Lv 1 2 pts. 8,117
  5. Avatar for kjs1728 115. kjs1728 Lv 1 2 pts. 8,116
  6. Avatar for scottwuzhear 116. scottwuzhear Lv 1 2 pts. 8,097
  7. Avatar for Skymint 117. Skymint Lv 1 2 pts. 8,088
  8. Avatar for jschroeter 118. jschroeter Lv 1 2 pts. 8,088
  9. Avatar for illex 119. illex Lv 1 1 pt. 8,070
  10. Avatar for KingKE 120. KingKE Lv 1 1 pt. 8,064

Comments