Placeholder image of a protein
Icon representing a puzzle

2083: Revisiting Puzzle 94: Mouse

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
December 16, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups


  1. Avatar for foldeRNA 11. foldeRNA 2 pts. 9,480
  2. Avatar for Russian team 12. Russian team 1 pt. 9,327
  3. Avatar for Void Crushers 13. Void Crushers 1 pt. 9,287
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 9,116
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,475
  6. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 7,426
  7. Avatar for Window Group 18. Window Group 1 pt. 6,794

  1. Avatar for nikiijiang 181. nikiijiang Lv 1 1 pt. 3,821
  2. Avatar for lucans1 182. lucans1 Lv 1 1 pt. 3,821
  3. Avatar for joshmiller 183. joshmiller Lv 1 1 pt. 3,821
  4. Avatar for Sciren 184. Sciren Lv 1 1 pt. 3,821
  5. Avatar for el carlitos 185. el carlitos Lv 1 1 pt. 3,821
  6. Avatar for ZeroLeak7 186. ZeroLeak7 Lv 1 1 pt. 3,821
  7. Avatar for Arthemian 187. Arthemian Lv 1 1 pt. 3,821
  8. Avatar for Abdulazizfauzi 188. Abdulazizfauzi Lv 1 1 pt. 3,821
  9. Avatar for joshjoshtesttest 189. joshjoshtesttest Lv 1 1 pt. 3,821
  10. Avatar for AndreyParpolit 190. AndreyParpolit Lv 1 1 pt. 3,821

Comments