Placeholder image of a protein
Icon representing a puzzle

2083: Revisiting Puzzle 94: Mouse

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
December 16, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for foldeRNA 11. foldeRNA 2 pts. 9,480
  2. Avatar for Russian team 12. Russian team 1 pt. 9,327
  3. Avatar for Void Crushers 13. Void Crushers 1 pt. 9,287
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 9,116
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,475
  6. Avatar for Biochimica generale - Medicina RA 16. Biochimica generale - Medicina RA 1 pt. 8,029
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 7,426
  8. Avatar for Window Group 18. Window Group 1 pt. 6,794
  1. Avatar for dario12345 191. dario12345 Lv 1 1 pt. 3,821
  2. Avatar for jprime1789 192. jprime1789 Lv 1 1 pt. 3,821
  3. Avatar for ume 193. ume Lv 1 1 pt. 3,821
  4. Avatar for deimo.22 194. deimo.22 Lv 1 1 pt. 3,821
  5. Avatar for spvincent 195. spvincent Lv 1 1 pt. 3,821
  6. Avatar for rmoretti 196. rmoretti Lv 1 1 pt. 3,821

Comments