Placeholder image of a protein
Icon representing a puzzle

2083: Revisiting Puzzle 94: Mouse

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
December 16, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for foldeRNA 11. foldeRNA 2 pts. 9,480
  2. Avatar for Russian team 12. Russian team 1 pt. 9,327
  3. Avatar for Void Crushers 13. Void Crushers 1 pt. 9,287
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 9,116
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,475
  6. Avatar for Biochimica generale - Medicina RA 16. Biochimica generale - Medicina RA 1 pt. 8,029
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 7,426
  8. Avatar for Window Group 18. Window Group 1 pt. 6,794
  1. Avatar for @lison 51. @lison Lv 1 23 pts. 9,601
  2. Avatar for AlkiP0Ps 52. AlkiP0Ps Lv 1 22 pts. 9,516
  3. Avatar for Alistair69 53. Alistair69 Lv 1 22 pts. 9,507
  4. Avatar for deus911 54. deus911 Lv 1 21 pts. 9,480
  5. Avatar for abiogenesis 55. abiogenesis Lv 1 20 pts. 9,460
  6. Avatar for fishercat 56. fishercat Lv 1 20 pts. 9,458
  7. Avatar for zackallen 57. zackallen Lv 1 19 pts. 9,457
  8. Avatar for Hellcat6 58. Hellcat6 Lv 1 18 pts. 9,431
  9. Avatar for Wildcard 34 59. Wildcard 34 Lv 1 18 pts. 9,407
  10. Avatar for rezaefar 60. rezaefar Lv 1 17 pts. 9,340

Comments