Placeholder image of a protein
Icon representing a puzzle

2083: Revisiting Puzzle 94: Mouse

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
December 16, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for foldeRNA 11. foldeRNA 2 pts. 9,480
  2. Avatar for Russian team 12. Russian team 1 pt. 9,327
  3. Avatar for Void Crushers 13. Void Crushers 1 pt. 9,287
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 9,116
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,475
  6. Avatar for Biochimica generale - Medicina RA 16. Biochimica generale - Medicina RA 1 pt. 8,029
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 7,426
  8. Avatar for Window Group 18. Window Group 1 pt. 6,794
  1. Avatar for tracybutt 81. tracybutt Lv 1 8 pts. 8,840
  2. Avatar for kaylut 82. kaylut Lv 1 7 pts. 8,831
  3. Avatar for Yoriichi 83. Yoriichi Lv 1 7 pts. 8,791
  4. Avatar for LPOy 84. LPOy Lv 1 7 pts. 8,784
  5. Avatar for zannipietro 85. zannipietro Lv 1 6 pts. 8,670
  6. Avatar for cjddig 86. cjddig Lv 1 6 pts. 8,622
  7. Avatar for schniouf 87. schniouf Lv 1 6 pts. 8,530
  8. Avatar for Keresto 88. Keresto Lv 1 6 pts. 8,512
  9. Avatar for JOE.CADILLAC555 89. JOE.CADILLAC555 Lv 1 5 pts. 8,511
  10. Avatar for WandaVision 90. WandaVision Lv 1 5 pts. 8,510

Comments