Placeholder image of a protein
Icon representing a puzzle

2083: Revisiting Puzzle 94: Mouse

Closed since over 4 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 16, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups


  1. Avatar for Beta Folders 100 pts. 10,505
  2. Avatar for Contenders 2. Contenders 74 pts. 10,477
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 54 pts. 10,435
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 10,425
  5. Avatar for Go Science 5. Go Science 27 pts. 10,412
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 10,374
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 10,139
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 8 pts. 9,627
  9. Avatar for SETI.Germany 9. SETI.Germany 5 pts. 9,609
  10. Avatar for Australia 10. Australia 3 pts. 9,516

  1. Avatar for alcor29 11. alcor29 Lv 1 2 pts. 10,357
  2. Avatar for Pikamander2 12. Pikamander2 Lv 1 1 pt. 10,345
  3. Avatar for georg137 13. georg137 Lv 1 1 pt. 10,340
  4. Avatar for Oransche 14. Oransche Lv 1 1 pt. 10,334
  5. Avatar for CharaLilith 15. CharaLilith Lv 1 1 pt. 10,334
  6. Avatar for BootsMcGraw 16. BootsMcGraw Lv 1 1 pt. 10,320
  7. Avatar for phi16 17. phi16 Lv 1 1 pt. 10,309
  8. Avatar for jamiexq 18. jamiexq Lv 1 1 pt. 10,272

Comments