Placeholder image of a protein
Icon representing a puzzle

2083: Revisiting Puzzle 94: Mouse

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
December 16, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups


  1. Avatar for Beta Folders 100 pts. 10,505
  2. Avatar for Contenders 2. Contenders 74 pts. 10,477
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 54 pts. 10,435
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 10,425
  5. Avatar for Go Science 5. Go Science 27 pts. 10,412
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 10,374
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 10,139
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 8 pts. 9,627
  9. Avatar for SETI.Germany 9. SETI.Germany 5 pts. 9,609
  10. Avatar for Australia 10. Australia 3 pts. 9,516

  1. Avatar for Poggi 171. Poggi Lv 1 1 pt. 5,283
  2. Avatar for Mike0306 172. Mike0306 Lv 1 1 pt. 5,267
  3. Avatar for Emirates 173. Emirates Lv 1 1 pt. 5,143
  4. Avatar for bananabread 175. bananabread Lv 1 1 pt. 4,694
  5. Avatar for Cihan40 176. Cihan40 Lv 1 1 pt. 4,385
  6. Avatar for Jupiters 177. Jupiters Lv 1 1 pt. 4,368
  7. Avatar for swag4u 178. swag4u Lv 1 1 pt. 4,175
  8. Avatar for gumbi80 179. gumbi80 Lv 1 1 pt. 3,821
  9. Avatar for dario12345 180. dario12345 Lv 1 1 pt. 3,821

Comments